PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013629559.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family EIL
Protein Properties Length: 571aa    MW: 65274.1 Da    PI: 6.2127
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013629559.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3494.94.2e-151484291354
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     +el++rmw+d+m+lkrlke++ + +  ke    +k++++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WW
  XP_013629559.1  48 DELERRMWRDKMRLKRLKEQQSK-C--KEGVDASKQQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWW 139
                     79******************998.4..56644567789********************************************************* PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT- CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdq 190
                     k+kv+fdrngpaai+kyqa+n+i++g++++++    ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+G+e+ww+ l+l+ dq
  XP_013629559.1 140 KDKVRFDRNGPAAIAKYQAENNIAGGSNDCNSFVGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPNGREEWWPLLSLPSDQ 234
                     ******************************999************************************************************** PP

                     -.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXX.XXXXXXXXXXXX CS
            EIN3 191 gtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrk.qspkvtlsceqk 281
                       ppykkphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee  +++++++s    s+++ +s ++ +++ ++
  XP_013629559.1 235 ASPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEVVARELYPESClplSSKSvGSGSLLINDCSE 329
                     *************************************************************************55555434359*********** PP

                     XXXX..XXXXXX.XXXXXXXXXX.........................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXX CS
            EIN3 282 edve..gkkeskikhvqavktta.........................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsi 349
                     +dve   k++++  +v++ k +                           +  + krk++++ +  ++ ++   tc++ q+++s+ +l+f+d++s+
  XP_013629559.1 330 YDVEcfDKEQQQSFDVEELKPEIvvsmnrptsfgicrmqqfpvkeevvATVGNLKRKQNNDLNVLMMMERPGFTCENGQCPHSKINLGFQDRSSR 424
                     ****95444444458888888769*******************99986444556888889999999999999*********************** PP

                     XXXXX CS
            EIN3 350 sqney 354
                     +++++
  XP_013629559.1 425 DNHQM 429
                     ***96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.4E-12948298No hitNo description
Gene3DG3DSA:1.10.3180.103.8E-73174308IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.03E-59177301IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MMMFNEMGMY GNMDFFSSTS LGETDVCPFP KDHPVVEDDY TDDEVDVDEL ERRMWRDKMR  60
LKRLKEQQSK CKEGVDASKQ QRQSQEQARR KKMSRAQDGI LKYMLKMMEV CKAQGFVYGI  120
IPEKGKPVTG ASDNLREWWK DKVRFDRNGP AAIAKYQAEN NIAGGSNDCN SFVGPTPHTL  180
QELQDTTLGS LLSALMQHCD PPQRRFPLEK GVPPPWWPNG REEWWPLLSL PSDQASPPYK  240
KPHDLKKAWK VGVLTAVIKH MSPDIAKIRK LVRQSKCLQD KMTAKESATW LAIINQEEVV  300
ARELYPESCL PLSSKSVGSG SLLINDCSEY DVECFDKEQQ QSFDVEELKP EIVVSMNRPT  360
SFGICRMQQF PVKEEVVATV GNLKRKQNND LNVLMMMERP GFTCENGQCP HSKINLGFQD  420
RSSRDNHQMV CPYRDNRLAY GVRPVVVSQQ SQPFPQPVQP IDLSGYGVPK NGQKMITELM  480
AMYDRNVQSS QASNQSMIID STAAQNYQEQ QLCFNRNQMF MQQGNSEINN QSQMVFDSTS  540
FDISSFDYKN DWQAGVMEGM GKQQQDVSIW F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-831763082134Protein ETHYLENE INSENSITIVE 3
4zds_B1e-831763082134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893330.0AC189333.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB038M13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629558.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
RefseqXP_013629559.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
RefseqXP_013629560.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotQ9SLH00.0EIL1_ARATH; ETHYLENE INSENSITIVE 3-like 1 protein
TrEMBLA0A0D3B7E60.0A0A0D3B7E6_BRAOL; Uncharacterized protein
STRINGBra000528.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.10.0ETHYLENE-INSENSITIVE3-like 1